PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 251aa    MW: 27903.3 Da    PI: 9.1603
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541440.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-14136180347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r    +Rt+ q+ s+ qky
   XP_010541440.1 136 PWTEEEHKLFLMGLKKYGKGDWRNISRNYVITRTPTQVASHAQKY 180
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.1962681IPR017884SANT domain
SMARTSM007171.3E-72779IPR001005SANT/Myb domain
CDDcd001671.52E-63076No hitNo description
SuperFamilySSF466892.31E-103084IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-12128185IPR009057Homeodomain-like
PROSITE profilePS5129421.604129185IPR017930Myb domain
SuperFamilySSF466897.25E-17131184IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17132184IPR006447Myb domain, plants
SMARTSM007176.7E-13133183IPR001005SANT/Myb domain
PfamPF002495.4E-13136180IPR001005SANT/Myb domain
CDDcd001675.47E-11136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEILRPTSHV TGGNWLRPEE TAKNSSAGAT WTAAENKAFE NALAVYDEDS PDRWQKVAAM  60
IPGKTVSDVI KQYTELEADV SNIEAGLVPV PGYIMPSPQF TLDWTAAAGY KELKAMGNKR  120
PTAARPPEHE RKKGVPWTEE EHKLFLMGLK KYGKGDWRNI SRNYVITRTP TQVASHAQKY  180
FIRQLSGGKD KRRASIHDIT TFNLDDDEAH VKSSVTVNSP ALIIPWSNSS SSSNGQSFNS  240
TLSFHSSYPH I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-182293273RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541440.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010541441.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-98DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM4CEH91e-114M4CEH9_BRARP; Uncharacterized protein
STRINGBra002610.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-115Homeodomain-like transcriptional regulator